PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zpz_sc00365.1.g00300.1.am.mk
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family bZIP
Protein Properties Length: 661aa    MW: 72551.4 Da    PI: 9.0486
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zpz_sc00365.1.g00300.1.am.mkgenomeZGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_130.58.1e-10434486557
                                   CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
                        bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkeva 57 
                                   kr +r   NR +A rs +RK  +++eLe+kv+ L++e ++L  +l  l+  +a
  Zpz_sc00365.1.g00300.1.am.mk 434 KRVKRVLANRQSAARSKERKMRYMAELEQKVQILQTEATTLSAQLTLLQRDSA 486
                                   999*****************************************999987766 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003384.4E-16430494IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.576432495IPR004827Basic-leucine zipper domain
PfamPF001707.6E-9434486IPR004827Basic-leucine zipper domain
SuperFamilySSF579597.74E-11434484No hitNo description
Gene3DG3DSA:1.20.5.1701.8E-9434486No hitNo description
CDDcd147032.72E-22435486No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 661 aa     Download sequence    Send to blast
MQQQQWHMPY HEDALLRPGS SGSARARPSL QKRRRDRHHI ITATDGPDHL HSMCLHDCVG  60
PTRFLAGRKP FFSQPLPSAP PPSSSSLCLS FVFQSTRVAP QGACGTEQGR KQTGCRRAEA  120
TEAVRAVDRQ TEGQPNGALK APARAKHRSI RFHRRPPRLH RQRQRSNGTS PPPPWSFRAT  180
MNGAADAHAA SLMQQELLQA ARLQQQPPQG MTSSMPTSNK PRLPGLPPTP PQRALDACMD  240
VDPAARNTAH RRSRSDVPFD YFPPPKVEAG WGGGHDDADE LFDSYLNLDG LDGVNNSSEE  300
RRDDGDSRGS SMKTNGADSS ENESEEGAAA DSRAAGIRLW AADGVEGLNH RGGPGGQPGA  360
APAPRHARSL SMDSLIGNGK FNCAAGGMTS GANAIMPGPN RFSLEFGSGE FTPAEMKKIM  420
ADEKLAEMAL ADPKRVKRVL ANRQSAARSK ERKMRYMAEL EQKVQILQTE ATTLSAQLTL  480
LQRDSAGIAT QNSELQFRIR AMEQQAQLRD AVFVNVRCAK HERRLAVVLD TCSLEKLYPA  540
AGVDDDMLAC PRPVRGGRMQ VGSWWRLAFR EYTIASCANT GSPLNEALTA EVQRLKLATA  600
ELGDSCSSNN LVQQIQLNVQ EQMFQLQQQQ QQQQQQATPI PFYQLQHPQQ SGAPENHEFK  660
E
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF1210981e-133EF121098.2 Zoysia japonica clone GB-ZJM-129 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004985885.11e-128PREDICTED: transcription factor RF2b-like
TrEMBLA0A0A9D7S71e-131A0A0A9D7S7_ARUDO; Uncharacterized protein
STRINGSi035841m1e-128(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP35363576
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38900.37e-42bZIP family protein